HLA DPB1 Antibody [mFluor Violet 610 SE]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: mFluor Violet 610 SE

HLA DPB1 Antibody [mFluor Violet 610 SE] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of human HLA DPB1 (NP_002112.3).
  
  Sequence:
  GRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-DPB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for HLA DPB1 Antibody [mFluor Violet 610 SE]

• DP beta 1 chain
• DPB1
• HLA class II histocompatibility antigen, DP(W4) beta chain
• HLA DP14-beta chain
• HLA-DP histocompatibility type, beta-1 subunit
• HLA-DP1B
• HLA-DPB
• major histocompatibility complex class II HLA DPB1 protein
• major histocompatibility complex, class II, DP beta 1
• MHC class II antigen beta chain
• MHC class II antigen DP beta 1 chain
• MHC class II antigen DPB1
• MHC class II antigen DPbeta1
• MHC class II HLA-DP-beta
• MHC HLA DPB1

Background

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLA-DPB1