Recombinant Human HLA DMB Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HLA DMB Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-108 of Human HLA-DMB partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HLA-DMB
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HLA DMB Protein

  • class II histocompatibility antigen, M beta chain
  • D6S221E
  • DMB
  • major histocompatibility complex, class II, DM beta
  • MHC class II antigen DMB
  • MHC class II antigen HLA-DM beta chain
  • MHC class II HLA-DMB
  • Really interesting new gene 7 protein
  • RING7HLA class II histocompatibility antigen, DM beta chain

Background

HLA-DMB - major histocompatibility complex, class II, DM beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
MAB6967
Species: Hu
Applications: WB
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003109-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HLA DMB Partial Recombinant Protein (H00003109-Q01) (0)

There are no publications for HLA DMB Partial Recombinant Protein (H00003109-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DMB Partial Recombinant Protein (H00003109-Q01) (0)

There are no reviews for HLA DMB Partial Recombinant Protein (H00003109-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DMB Partial Recombinant Protein (H00003109-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLA DMB Products

Bioinformatics Tool for HLA DMB Partial Recombinant Protein (H00003109-Q01)

Discover related pathways, diseases and genes to HLA DMB Partial Recombinant Protein (H00003109-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DMB Partial Recombinant Protein (H00003109-Q01)

Discover more about diseases related to HLA DMB Partial Recombinant Protein (H00003109-Q01).
 

Pathways for HLA DMB Partial Recombinant Protein (H00003109-Q01)

View related products by pathway.

PTMs for HLA DMB Partial Recombinant Protein (H00003109-Q01)

Learn more about PTMs related to HLA DMB Partial Recombinant Protein (H00003109-Q01).
 

Research Areas for HLA DMB Partial Recombinant Protein (H00003109-Q01)

Find related products by research area.

Blogs on HLA DMB

There are no specific blogs for HLA DMB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HLA DMB Antibody
NBP1-85326
POMC Antibody
NB100-1533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HLA DMB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DMB