HLA DMB Antibody

Western Blot: HLA DMB Antibody [H00003109-D01P] - Analysis of HLA-DMB expression in transfected 293T cell line by HLA-DMB polyclonal antibody.Lane 1: HLA-DMB transfected lysate(28.90 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

HLA DMB Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: HLA-DMB (NP_002109.1, 1 a.a. - 263 a.a.) full-length human protein. MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS
• Specificity: Reacts with major histocompatibility complex, class II, DM beta.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-DMB
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DMB Antibody

• class II histocompatibility antigen, M beta chain
• D6S221E
• DMB
• major histocompatibility complex, class II, DM beta
• MHC class II antigen DMB
• MHC class II antigen HLA-DM beta chain
• MHC class II HLA-DMB
• Really interesting new gene 7 protein
• RING7HLA class II histocompatibility antigen, DM beta chain

Background

HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLA-DMB
• Uniprot:
  • NP_002109.1(Human)