HLA C Antibody - BSA Free

Western Blot: HLA C Antibody [NBP2-86667] - WB Suggested Anti-HLA-C Antibody. Titration: 1.0 ug/ml. Positive Control: MDA-MB-435S Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HLA C Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the HLA C-terminal region of HLA C. Peptide sequence: PPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVET The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HLA C Antibody - BSA Free

• C alpha chain
• D6S204
• FLJ27082
• HLA class I histocompatibility antigen, Cw-1 alpha chain
• HLAC
• HLA-C
• HLA-Cw
• HLA-JY3
• HLC-C
• human leukocyte antigen-C alpha chain
• leucocyte antigen C
• leucocyte antigen Cw
• leukocyte antigen-C alpha chain
• major histocompatibility antigen HLA-C
• major histocompatibility complex, class I, C
• MHC class I antigen Cw*1
• MHC class I antigen Cw*12
• MHC class I antigen Cw*14
• MHC class I antigen Cw*15
• MHC class I antigen Cw*16
• MHC class I antigen Cw*17
• MHC class I antigen Cw*2
• MHC class I antigen Cw*3
• MHC class I antigen Cw*4
• MHC class I antigen Cw*5
• MHC class I antigen Cw*6
• MHC class I antigen Cw*7
• MHC class I antigen Cw*8
• MHC class I antigen heavy chain HLA-C
• PSORS1

Background

HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Over one hundred HLA-C alleles have been described [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLA-C