HIVEP2 Antibody

Product Discontinued

HIVEP2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IQPTSYMTSKHLPEQPHLFPHQETIPFSPIQNALFQFQYPTVCMVHLPAQQPPWWQAHFPHPFAQHPQKSYGKPSFQTEIHSSYP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HIVEP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HIVEP2 Antibody

• c-myc intron binding protein 1
• c-myc intron-binding protein 1
• human immunodeficiency virus type I enhancer binding protein 2
• Human immunodeficiency virus type I enhancer-binding protein 2HIV-EP2MBP-2SHN2
• MHC binding protein-2
• MHC-binding protein 2
• MIBP1
• Schnurri-2
• transcription factor HIVEP2
• ZAS2
• ZNF40B

Background

Members of the ZAS family, such as ZAS2 (HIVEP2), are large proteins that contain a ZAS domain, a modular proteinstructure consisting of a pair of C2H2 zinc fingers with an acidic-rich region and a serine/threonine-rich sequence.These proteins bind specific DNA sequences, including the kappa-B motif (GGGACTTTCC), in the promoters and enhancerregions of several genes and viruses, including human immunodeficiency virus (HIV). ZAS genes span more than 150 kband contain at least 10 exons, one of which is longer than 5.5 kb (Allen and Wu, 2004).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HIVEP2
• Uniprot:
  • P31629(Human)