Histamine H2R Recombinant Protein Antigen

Images

 
There are currently no images for Histamine H2R Recombinant Protein Antigen (NBP1-86082PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Histamine H2R Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HRH2.

Source: E. coli

Amino Acid Sequence: NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HRH2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86082.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Histamine H2R Recombinant Protein Antigen

  • Gastric Receptor 1
  • Gastric receptor I
  • H2R
  • HH2R
  • Histamine H2 R
  • histamine H2 receptor
  • Histamine H2R
  • histamine receptor H2
  • HRH2

Background

HRH2 encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4726
Species: Hu
Applications: CyTOF-ready, Flow
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NLS476
Species: Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
202-IL
Species: Hu
Applications: BA
NB100-2803
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
DY413
Species: Mu
Applications: ELISA
NBP2-16800
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-46349
Species: Hu
Applications: IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-13923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91832
Species: Hu
Applications: IHC,  IHC-P
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-89495
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Histamine H2R Recombinant Protein Antigen (NBP1-86082PEP) (0)

There are no publications for Histamine H2R Recombinant Protein Antigen (NBP1-86082PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histamine H2R Recombinant Protein Antigen (NBP1-86082PEP) (0)

There are no reviews for Histamine H2R Recombinant Protein Antigen (NBP1-86082PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Histamine H2R Recombinant Protein Antigen (NBP1-86082PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Histamine H2R Products

Research Areas for Histamine H2R Recombinant Protein Antigen (NBP1-86082PEP)

Find related products by research area.

Blogs on Histamine H2R

There are no specific blogs for Histamine H2R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Histamine H2R Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HRH2