HIRIP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HIRIP3 Antibody [NBP2-55101] - Staining of human cell line HeLa shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIRIP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EASSPDYFGPPAKNGVAAEVSPAKEENPRRASKAVEESSDEERQRDLPAQRGEESSEEEEKGYKGKTRKKPVVKKQAPGKASVSRKQA
Specificity
Specificity of human HIRIP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIRIP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HIRIP3 Recombinant Protein Antigen (NBP2-55101PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HIRIP3 Antibody

  • HIRA interacting protein 3
  • HIRA-interacting protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38636
Species: Hu
Applications: IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
H00008294-P01
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
NBP2-54770
Species: Hu, Y, Ye
Applications: WB, ChIP, ELISA, ICC/IF, ChIP
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-83302
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP2-55101
Species: Hu
Applications: ICC/IF

Publications for HIRIP3 Antibody (NBP2-55101) (0)

There are no publications for HIRIP3 Antibody (NBP2-55101).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIRIP3 Antibody (NBP2-55101) (0)

There are no reviews for HIRIP3 Antibody (NBP2-55101). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HIRIP3 Antibody (NBP2-55101) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HIRIP3 Antibody (NBP2-55101)

Discover related pathways, diseases and genes to HIRIP3 Antibody (NBP2-55101). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIRIP3 Antibody (NBP2-55101)

Discover more about diseases related to HIRIP3 Antibody (NBP2-55101).
 

Pathways for HIRIP3 Antibody (NBP2-55101)

View related products by pathway.

PTMs for HIRIP3 Antibody (NBP2-55101)

Learn more about PTMs related to HIRIP3 Antibody (NBP2-55101).

Blogs on HIRIP3

There are no specific blogs for HIRIP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIRIP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIRIP3