hHR23b Recombinant Protein Antigen

Images

 
There are currently no images for hHR23b Protein (NBP1-89698PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

hHR23b Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD23B.

Source: E. coli

Amino Acid Sequence: LPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAD23B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89698.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for hHR23b Recombinant Protein Antigen

  • HHR23B
  • HR23BUV excision repair protein RAD23 homolog B
  • P58
  • RAD23 (S. cerevisiae) homolog B
  • RAD23 homolog B (S. cerevisiae)
  • RAD23, yeast homolog of, B
  • XP-C repair complementing complex 58 kDa
  • XP-C repair complementing protein
  • XP-C repair-complementing complex 58 kDa protein

Background

hHR23b is encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4555
Species: Hu, Mu, Rt, Ye
Applications: WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-48704
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-03381
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-77266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF3416
Species: Hu
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
H00000902-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP
NBP3-25371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-15704
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-496
Species: Hu
Applications: IHC,  IHC-P, IP, WB

Publications for hHR23b Protein (NBP1-89698PEP) (0)

There are no publications for hHR23b Protein (NBP1-89698PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hHR23b Protein (NBP1-89698PEP) (0)

There are no reviews for hHR23b Protein (NBP1-89698PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for hHR23b Protein (NBP1-89698PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional hHR23b Products

Research Areas for hHR23b Protein (NBP1-89698PEP)

Find related products by research area.

Blogs on hHR23b

There are no specific blogs for hHR23b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our hHR23b Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD23B