Recombinant Human hHR23b GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP, KA

Order Details

Recombinant Human hHR23b GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 311-409 of Human hHR23b

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAD23B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00005887-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human hHR23b GST (N-Term) Protein

  • HHR23B
  • HR23BUV excision repair protein RAD23 homolog B
  • P58
  • RAD23 (S. cerevisiae) homolog B
  • RAD23 homolog B (S. cerevisiae)
  • RAD23, yeast homolog of, B
  • XP-C repair complementing complex 58 kDa
  • XP-C repair complementing protein
  • XP-C repair-complementing complex 58 kDa protein

Background

The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52549
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-16195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-03381
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
AF1058
Species: Hu, Mu, Ca
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-74611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-50419
Species: Hu, Mu
Applications: WB, Flow, IP, CyTOF-ready
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-496
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for hHR23b Partial Recombinant Protein (H00005887-Q01)(1)

Reviews for hHR23b Partial Recombinant Protein (H00005887-Q01) (0)

There are no reviews for hHR23b Partial Recombinant Protein (H00005887-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for hHR23b Partial Recombinant Protein (H00005887-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional hHR23b Products

Bioinformatics Tool for hHR23b Partial Recombinant Protein (H00005887-Q01)

Discover related pathways, diseases and genes to hHR23b Partial Recombinant Protein (H00005887-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hHR23b Partial Recombinant Protein (H00005887-Q01)

Discover more about diseases related to hHR23b Partial Recombinant Protein (H00005887-Q01).
 

Pathways for hHR23b Partial Recombinant Protein (H00005887-Q01)

View related products by pathway.

PTMs for hHR23b Partial Recombinant Protein (H00005887-Q01)

Learn more about PTMs related to hHR23b Partial Recombinant Protein (H00005887-Q01).
 

Research Areas for hHR23b Partial Recombinant Protein (H00005887-Q01)

Find related products by research area.

Blogs on hHR23b

There are no specific blogs for hHR23b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human hHR23b GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD23B