hHpr1-p84-Thoc1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Staining of human cerebral cortex, colon, skeletal muscle and testis using Anti-THOC1 antibody NBP1-89669 (A) shows similar protein distribution across tissues to independent antibody NBP1-89670 (B).

Immunohistochemistry-Paraffin: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Staining in human appendix and skeletal muscle tissues using anti-THOC1 antibody. Corresponding THOC1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Staining of human appendix shows high expression.

Immunohistochemistry-Paraffin: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Staining of human skeletal muscle using Anti-THOC1 antibody NBP1-89669.

Immunohistochemistry-Paraffin: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Staining of human testis.

Immunohistochemistry-Paraffin: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Staining of human colon.

Western Blot: hHpr1-p84-Thoc1 Antibody [NBP1-89669] - Analysis using Anti-THOC1 antibody NBP1-89669 (A) shows similar pattern to independent antibody NBP1-89670 (B).

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

hHpr1-p84-Thoc1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWS
• Marker: Nuclear Marker
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THOC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization, Use PFA/Triton X-100. Western Blot verified by a customer review.
• Control Peptide:

  hHpr1-p84-Thoc1 Protein (NBP1-89669PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for hHpr1-p84-Thoc1 Antibody - BSA Free

• HPR1THO complex subunit 1
• hTREX84
• Nuclear matrix protein p84
• P84
• P84N5
• THO complex 1
• tho1

Background

P84/N5-5E10 recognizes an 84kDa nuclear matrix protein. Initially isolated by its interaction with the amino terminal region of the retinoblastoma protein, it has been used extensively as a nuclear-specific marker in both immunofluorescence and cell fractionation studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for hHpr1-p84-Thoc1 Antibody (NBP1-89669)(1)

Publication using NBP1-89669

• Dominguez-Sanchez MS, Saez C, Japon MA et al. Differential expression of THOC1 and ALY mRNP biogenesis/export factors in human cancers. BMC Cancer 2011-02-17 [PMID: 21329510]

Bioinformatics

• Gene Symbol: THOC1