HGD Antibody (3G4) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
HGD (NP_000178, 377 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN |
| Specificity |
HGD (3G4) |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
HGD |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Sandwich ELISA
|
| Application Notes |
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for HGD Antibody (3G4) - Azide and BSA Free
Background
Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Publications for HGD Antibody (H00003081-M10) (0)
There are no publications for HGD Antibody (H00003081-M10).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HGD Antibody (H00003081-M10) (0)
There are no reviews for HGD Antibody (H00003081-M10).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HGD Antibody (H00003081-M10) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HGD Products
Research Areas for HGD Antibody (H00003081-M10)
Find related products by research area.
|
Blogs on HGD