HGD Antibody (3G4)


Immunocytochemistry/ Immunofluorescence: HGD Antibody (3G4) [H00003081-M10] - Analysis of monoclonal antibody to HGD on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: HGD Antibody (3G4) [H00003081-M10] - Detection limit for recombinant GST tagged HGD is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF

Order Details

HGD Antibody (3G4) Summary

HGD (NP_000178 377 a.a. - 445 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
HGD (3G4)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HGD Antibody (3G4)

  • AKU
  • EC
  • HGOFLJ94126
  • homogentisate 1,2-dioxygenase (homogentisate oxidase)
  • homogentisate 1,2-dioxygenase
  • homogentisate oxidase
  • Homogentisate oxygenase
  • Homogentisic acid oxidase
  • homogentisicase


Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF

Publications for HGD Antibody (H00003081-M10) (0)

There are no publications for HGD Antibody (H00003081-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HGD Antibody (H00003081-M10) (0)

There are no reviews for HGD Antibody (H00003081-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HGD Antibody (H00003081-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HGD Products

Bioinformatics Tool for HGD Antibody (H00003081-M10)

Discover related pathways, diseases and genes to HGD Antibody (H00003081-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGD Antibody (H00003081-M10)

Discover more about diseases related to HGD Antibody (H00003081-M10).

Pathways for HGD Antibody (H00003081-M10)

View related products by pathway.

PTMs for HGD Antibody (H00003081-M10)

Learn more about PTMs related to HGD Antibody (H00003081-M10).

Blogs on HGD

There are no specific blogs for HGD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HGD Antibody (3G4) and receive a gift card or discount.


Gene Symbol HGD