Hexokinase 2 Antibody (4H1)

Images

 
Western Blot: Hexokinase 2 Antibody (4H1) [H00003099-M01] - HK2 monoclonal antibody (M01), clone 4H1. Analysis of HK2 expression in PC-12.
Western Blot: Hexokinase 2 Antibody (4H1) [H00003099-M01] - HK2 monoclonal antibody (M01), clone 4H1. Analysis of HK2 expression in A-431.
Sandwich ELISA: Hexokinase 2 Antibody (4H1) [H00003099-M01] - Detection limit for recombinant GST tagged HK2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
4H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hexokinase 2 Antibody (4H1) Summary

Immunogen
HK2 (AAH21116 818 a.a. - 917 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKGAALITAVACRIREAGQR
Specificity
HK2 - hexokinase 2 (4H1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00003099-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hexokinase 2 Antibody (4H1)

  • DKFZp686M1669
  • EC 2.7.1
  • Hexokinase 2
  • Hexokinase type II
  • HK2
  • HKII
  • HXK2
  • Muscle form hexokinase
  • muscle

Background

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hexokinase 2 Antibody (H00003099-M01)(2)

Reviews for Hexokinase 2 Antibody (H00003099-M01) (0)

There are no reviews for Hexokinase 2 Antibody (H00003099-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hexokinase 2 Antibody (H00003099-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hexokinase 2 Products

Bioinformatics Tool for Hexokinase 2 Antibody (H00003099-M01)

Discover related pathways, diseases and genes to Hexokinase 2 Antibody (H00003099-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hexokinase 2 Antibody (H00003099-M01)

Discover more about diseases related to Hexokinase 2 Antibody (H00003099-M01).
 

Pathways for Hexokinase 2 Antibody (H00003099-M01)

View related products by pathway.

PTMs for Hexokinase 2 Antibody (H00003099-M01)

Learn more about PTMs related to Hexokinase 2 Antibody (H00003099-M01).
 

Research Areas for Hexokinase 2 Antibody (H00003099-M01)

Find related products by research area.

Blogs on Hexokinase 2

There are no specific blogs for Hexokinase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hexokinase 2 Antibody (4H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol HK2
Entrez
Uniprot