HERV Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HERV. Peptide sequence: CMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPRNCYHSA The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ERVW-1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for HERV Antibody - BSA Free
Background
HERVs are a class of multiple sclerosis associated retroviruses. Reacts with a replication competent Human Endogenous Retrovirus (HERVW) isolated from placenta. The synthetic peptide sequence used as immunogen is taken from the virus envelope polyprotein sequence. Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. The HERVW endogenous envelope protein has retained its original fusogenic properties and participates in trophoblast fusion during placenta morphogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Publications for HERV Antibody (NBP2-86666) (0)
There are no publications for HERV Antibody (NBP2-86666).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HERV Antibody (NBP2-86666) (0)
There are no reviews for HERV Antibody (NBP2-86666).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HERV Antibody (NBP2-86666) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HERV Products
Research Areas for HERV Antibody (NBP2-86666)
Find related products by research area.
|
Blogs on HERV