Recombinant Human HERV GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HERV GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 116-215 of Human HERV

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLRTHTRLVSLFNTTLTGLHEVSAQNPTNCWICLPLNFRPYVSIPVPEQWNNFSTEINT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ERVW-1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00030816-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HERV GST (N-Term) Protein

  • endogenous retroviral family W, env(C7), member 1
  • ENV
  • envelope glycoprotein
  • Envelope polyprotein gPr73
  • enverin
  • ENVW
  • Env-W
  • HERV-7q Envelope protein
  • HERV7Q
  • HERV-7q
  • HERV-tryptophan envelope protein
  • HERV-W Env glycoprotein
  • HERV-W envelope protein
  • HERV-W
  • HERV-W_7q21.2 provirus ancestral Env polyprotein
  • HERV-W{7q21.1} provirus ancestral Env polyprotein
  • HERVWENV
  • HERV-W-ENV
  • HERVWenvelope protein
  • human endogenous retrovirus W envC7-1 envelope protein
  • syncytin A
  • Syncytin
  • syncytin-1

Background

ERVWE1 - endogenous retroviral family W, env(C7), member 1 (syncytin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89327
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
H00008521-M05
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB600-799
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-80963
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38226
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-81929
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for HERV Partial Recombinant Protein (H00030816-Q01)(2)

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
All Species

Reviews for HERV Partial Recombinant Protein (H00030816-Q01) (0)

There are no reviews for HERV Partial Recombinant Protein (H00030816-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HERV Partial Recombinant Protein (H00030816-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HERV Products

Array H00030816-Q01

Bioinformatics Tool for HERV Partial Recombinant Protein (H00030816-Q01)

Discover related pathways, diseases and genes to HERV Partial Recombinant Protein (H00030816-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HERV Partial Recombinant Protein (H00030816-Q01)

Discover more about diseases related to HERV Partial Recombinant Protein (H00030816-Q01).

PTMs for HERV Partial Recombinant Protein (H00030816-Q01)

Learn more about PTMs related to HERV Partial Recombinant Protein (H00030816-Q01).
 

Research Areas for HERV Partial Recombinant Protein (H00030816-Q01)

Find related products by research area.

Blogs on HERV

There are no specific blogs for HERV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SLC1A5 Antibody
NBP1-89327

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HERV GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ERVW-1