Novus Biologicals products are now on bio-techne.com

Hephaestin Antibody (2D3)

Images

 
Western Blot: Hephaestin Antibody (2D3) [H00009843-M01] - PH monoclonal antibody (M01), clone 2D3 Western Blot analysis of HEPH expression in K-562 ( Cat # L009V1 ).
Sandwich ELISA: Hephaestin Antibody (2D3) [H00009843-M01] - Detection limit for recombinant GST tagged HEPH is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hephaestin Antibody (2D3) Summary

Immunogen
HEPH (NP_620074, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKSSSRI
Specificity
HEPH (2D3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HEPH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hephaestin Antibody (2D3)

  • EC 1.16.3.1
  • hephaestin
  • KIAA0698CPL

Background

The protein encoded by this gene is similar to an iron transport protein found in mouse. The mouse protein is similar to ceruloplasmin, a serum multi-copper ferroxidase, and is thought to be a membrane-bound protein responsible for transport of dietary iron from epithelial cells of the intestinal lumen into the circulatory system. In mouse, defects in this gene can lead to severe microcytic anemia. Two transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84071
Species: Hu
Applications: IHC, IHC-P, WB
MAB7509
Species: Hu
Applications: IHC, WB
NBP1-21502
Species: Bv, Hu, Mu, Po, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
NB300-914
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
2914-HT
Species: Hu
Applications: BA
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
DHP250
Species: Hu
Applications: ELISA
DHAPG0
Species: Hu
Applications: ELISA
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
NBP1-80744
Species: Hu
Applications: IHC, IHC-P
AF3720
Species: Hu, Mu
Applications: ICC, WB
NBP2-20454
Species: Hu
Applications: IHC, IHC-P, WB
E2-616
Species: Hu
Applications: EnzAct
H00009843-M01
Species: Hu
Applications: WB, ELISA

Publications for Hephaestin Antibody (H00009843-M01) (0)

There are no publications for Hephaestin Antibody (H00009843-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hephaestin Antibody (H00009843-M01) (0)

There are no reviews for Hephaestin Antibody (H00009843-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hephaestin Antibody (H00009843-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hephaestin Antibody (2D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HEPH
Entrez
OMIM
Uniprot