| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2A5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | HCN4 (NP_005468.1, 1105 a.a. ~ 1203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLPSNL |
| Specificity | This product is specific for Human HCN4 monoclonal antibody (M04), clone 2A5 [Gene ID: 10021]. |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | HCN4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Mouse monoclonal antibody raised against a partial recombinant HCN4. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HCN4 Antibody (H00010021-M04)Find related products by research area.
|
|
Taste Infographic: Explaining Taste from the Tongue to the Brain The sense of taste involves the reaction of chemicals with nerve cells which send messages to the brain to create the perception of flavor. Learn more about taste and in the infographic below.Novus Biologicals offers research reagents mentioned in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HCN4 |
| Uniprot |
|