Recombinant Human Hck Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Hck Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-80 of Human Hck

Source: Wheat Germ

Amino Acid Sequence: MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HCK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
34.43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hck Protein

  • Bmk
  • EC 2.7.10
  • EC 2.7.10.2
  • Hck
  • Hctk
  • hemopoietic cell kinaseJTK9
  • JTK9
  • p59-HCK/p60-HCK
  • tyrosine-protein kinase HCK

Background

HCK - hemopoietic cell kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB3207
Species: Hu, Mu, Rt
Applications: WB
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P

Publications for Hck Partial Recombinant Protein (H00003055-Q01) (0)

There are no publications for Hck Partial Recombinant Protein (H00003055-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hck Partial Recombinant Protein (H00003055-Q01) (0)

There are no reviews for Hck Partial Recombinant Protein (H00003055-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hck Partial Recombinant Protein (H00003055-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hck Products

Bioinformatics Tool for Hck Partial Recombinant Protein (H00003055-Q01)

Discover related pathways, diseases and genes to Hck Partial Recombinant Protein (H00003055-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hck Partial Recombinant Protein (H00003055-Q01)

Discover more about diseases related to Hck Partial Recombinant Protein (H00003055-Q01).
 

Pathways for Hck Partial Recombinant Protein (H00003055-Q01)

View related products by pathway.

PTMs for Hck Partial Recombinant Protein (H00003055-Q01)

Learn more about PTMs related to Hck Partial Recombinant Protein (H00003055-Q01).
 

Research Areas for Hck Partial Recombinant Protein (H00003055-Q01)

Find related products by research area.

Blogs on Hck

There are no specific blogs for Hck, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hck Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HCK
Entrez