HCCS Antibody

Images

 
Western Blot: HCCS Antibody [H00003052-D01P] - Analysis of HCCS expression in transfected 293T cell line by HCCS polyclonal antibody.Lane 1: HCCS transfected lysate(30.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HCCS Antibody Summary

Immunogen
HCCS (AAH01691.1, 1 a.a. - 268 a.a.) full-length human protein. MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HCCS
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HCCS Antibody

  • CCHLDKFZp779I1858
  • cytochrome c heme-lyase
  • cytochrome c-type heme lyase
  • EC 4.4.1.17
  • holocytochrome c synthase (cytochrome c heme-lyase)
  • holocytochrome c synthase
  • Holocytochrome c-type synthase
  • MCOPS7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
NBP1-80837
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP2-31703
Species: Hu
Applications: IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00003052-D01P
Species: Hu
Applications: WB

Publications for HCCS Antibody (H00003052-D01P) (0)

There are no publications for HCCS Antibody (H00003052-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HCCS Antibody (H00003052-D01P) (0)

There are no reviews for HCCS Antibody (H00003052-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HCCS Antibody (H00003052-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HCCS Products

Bioinformatics Tool for HCCS Antibody (H00003052-D01P)

Discover related pathways, diseases and genes to HCCS Antibody (H00003052-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HCCS Antibody (H00003052-D01P)

Discover more about diseases related to HCCS Antibody (H00003052-D01P).
 

Pathways for HCCS Antibody (H00003052-D01P)

View related products by pathway.

PTMs for HCCS Antibody (H00003052-D01P)

Learn more about PTMs related to HCCS Antibody (H00003052-D01P).

Blogs on HCCS

There are no specific blogs for HCCS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HCCS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HCCS
Uniprot