HBS1L Antibody


Western Blot: HBS1L Antibody [NBP1-85124] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA
Immunocytochemistry/ Immunofluorescence: HBS1L Antibody [NBP1-85124] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: HBS1L Antibody [NBP1-85124] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HBS1L Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF
Specificity of human HBS1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HBS1L Protein (NBP1-85124PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HBS1L Antibody

  • DKFZp434g247
  • ERF3-similar protein
  • ERFSDKFZp686L13262
  • HBS1 (S. cerevisiae)-like
  • HBS1KIAA1038EF-1a
  • HBS1-like (S. cerevisiae)
  • HBS1-like protein
  • Hsp70 subfamily B suppressor 1-like protein
  • HSPC276


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IP

Publications for HBS1L Antibody (NBP1-85124) (0)

There are no publications for HBS1L Antibody (NBP1-85124).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBS1L Antibody (NBP1-85124) (0)

There are no reviews for HBS1L Antibody (NBP1-85124). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HBS1L Antibody (NBP1-85124) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HBS1L Products

Bioinformatics Tool for HBS1L Antibody (NBP1-85124)

Discover related pathways, diseases and genes to HBS1L Antibody (NBP1-85124). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HBS1L Antibody (NBP1-85124)

Discover more about diseases related to HBS1L Antibody (NBP1-85124).

Pathways for HBS1L Antibody (NBP1-85124)

View related products by pathway.

Research Areas for HBS1L Antibody (NBP1-85124)

Find related products by research area.

Blogs on HBS1L

There are no specific blogs for HBS1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HBS1L Antibody and receive a gift card or discount.


Gene Symbol HBS1L