HBS1L Antibody

Images

 
Western Blot: HBS1L Antibody [NBP1-85124] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA
Immunocytochemistry/ Immunofluorescence: HBS1L Antibody [NBP1-85124] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: HBS1L Antibody [NBP1-85124] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HBS1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CITGKIEAGYIQTGDRLLAMPPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKVPIKACTRF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HBS1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HBS1L Protein (NBP1-85124PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HBS1L Antibody

  • DKFZp434g247
  • ERF3-similar protein
  • ERFSDKFZp686L13262
  • HBS1 (S. cerevisiae)-like
  • HBS1KIAA1038EF-1a
  • HBS1-like (S. cerevisiae)
  • HBS1-like protein
  • Hsp70 subfamily B suppressor 1-like protein
  • HSPC276

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-116
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38753
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-51077
Species: Hu
NBL1-16438
Species: Hu
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP

Publications for HBS1L Antibody (NBP1-85124) (0)

There are no publications for HBS1L Antibody (NBP1-85124).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBS1L Antibody (NBP1-85124) (0)

There are no reviews for HBS1L Antibody (NBP1-85124). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HBS1L Antibody (NBP1-85124) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HBS1L Products

Bioinformatics Tool for HBS1L Antibody (NBP1-85124)

Discover related pathways, diseases and genes to HBS1L Antibody (NBP1-85124). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HBS1L Antibody (NBP1-85124)

Discover more about diseases related to HBS1L Antibody (NBP1-85124).
 

Pathways for HBS1L Antibody (NBP1-85124)

View related products by pathway.

Research Areas for HBS1L Antibody (NBP1-85124)

Find related products by research area.

Blogs on HBS1L

There are no specific blogs for HBS1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HBS1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HBS1L