HBLD2 Antibody (2E9)

Images

 
Sandwich ELISA: HBLD2 Antibody (2E9) [H00081689-M01] - Detection limit for recombinant GST tagged HBLD2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HBLD2 Antibody (2E9) Summary

Immunogen
ISCA1 (AAH02675, 1 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI
Localization
Mitochondrion
Specificity
HBLD2 - HESB like domain containing 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ISCA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HBLD2 Antibody (2E9)

  • HESB like domain containing 2
  • HESB-like domain-containing protein 2
  • HISCA
  • hIscAmitochondrial
  • Iron-sulfur assembly protein IscA
  • iron-sulfur cluster assembly 1 homolog (S. cerevisiae)

Background

ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 [PubMed 15262227]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89716
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-06258
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-81853
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-94027
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90157
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NBP2-37933
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB9080
Species: Hu
Applications: WB
H00006193-M02
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
NB110-61010
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NB100-81029
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP1-89897
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84732
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00006583-A01
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
H00081689-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for HBLD2 Antibody (H00081689-M01) (0)

There are no publications for HBLD2 Antibody (H00081689-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBLD2 Antibody (H00081689-M01) (0)

There are no reviews for HBLD2 Antibody (H00081689-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HBLD2 Antibody (H00081689-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HBLD2 Products

Bioinformatics Tool for HBLD2 Antibody (H00081689-M01)

Discover related pathways, diseases and genes to HBLD2 Antibody (H00081689-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HBLD2 Antibody (H00081689-M01)

Discover more about diseases related to HBLD2 Antibody (H00081689-M01).
 

Pathways for HBLD2 Antibody (H00081689-M01)

View related products by pathway.

Blogs on HBLD2

There are no specific blogs for HBLD2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HBLD2 Antibody (2E9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ISCA1
Entrez
Uniprot