Home » HBLD2 » HBLD2 Antibodies » HBLD2 Antibody (2E9)

HBLD2 Antibody (2E9)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: HBLD2 Antibody (2E9) [H00081689-M01] - Detection limit for recombinant GST tagged HBLD2 is approximately 0.03ng/ml as a capture antibody.
Sandwich ELISA: HBLD2 Antibody (2E9) [H00081689-M01] - Detection limit for recombinant GST tagged HBLD2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HBLD2 Antibody (2E9) Summary

Immunogen
ISCA1 (AAH02675, 1 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI
Localization
Mitochondrion
Specificity
HBLD2 - HESB like domain containing 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ISCA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HBLD2 Antibody (2E9)

  • HESB like domain containing 2
  • HESB-like domain-containing protein 2
  • HISCA
  • hIscAmitochondrial
  • Iron-sulfur assembly protein IscA
  • iron-sulfur cluster assembly 1 homolog (S. cerevisiae)

Background

ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 [PubMed 15262227]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HBLD1 Antibody
NBP1-89716
Western Blot: HBLD1 Antibody [NBP1-89716] - Analysis in control (vector only transfected HEK293T lysate) and ISCA2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: HBLD1 Antibody [NBP1-89716] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
NARFL Antibody
NBP3-06258
Western Blot: NARFL Antibody [NBP3-06258] - Anti-NARFL rabbit polyclonal antibody at 1:500 dilutionLane A: Hela Whole Cell LysateLysatesroteins at 30 ug per lane.SecondaryGoat Anti-Rabbit IgG (H+L)HRP at 110000 dilution.Developed using the ECL technique.Performed under reducing conditions.Predicted band size:53 kDaObserved band size:57 kDa
Immunoprecipitation: NARFL Antibody [NBP3-06258] - NARFL was immunoprecipitated using:Lane A:0.5 mg HELA Whole Cell Lysate4 uL anti-NARFL rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein AG.Primary antibody:Anti-NARFL rabbit polyclonal antibody, at 1:100 dilution.Secondary antibody:Clean-Blot IP Detection Reagent (HRP) at 1:1000 dilutionDeveloped using the ECL technique.Performed under reducing conditions.Predicted band size: 56 kDaObserved band size :56 kDa
Western Blot: NARFL Antibody [NBP3-06258] - Anti-NARFL rabbit polyclonal antibody at 1:500 dilution.
Species: Hu
Applications: IHC, IHC-P, IP, WB
GALK1 Antibody
NBP1-81853
Western Blot: GALK1 Antibody [NBP1-81853] - Analysis using Anti-GALK1 antibody NBP1-81853 (A) shows similar pattern to independent antibody NBP1-81854 (B).
Immunocytochemistry/Immunofluorescence: GALK1 Antibody [NBP1-81853] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Western Blot: GALK1 Antibody [NBP1-81853] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IBA57 Antibody
NBP1-94027
Western Blot: C1orf69 Antibody [NBP1-94027] - Analysis in control (vector only transfected HEK293T lysate) and IBA57 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: C1orf69 Antibody [NBP1-94027] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
Annexin A13
Antibody
NBP1-90157
Immunocytochemistry/Immunofluorescence: Annexin A13 Antibody [NBP1-90157] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90157] - Staining of human duodenum, fallopian tube, gallbladder and small intestine using Anti-ANXA13 antibody NBP1-90157 (A) shows similar protein distribution across tissues to independent antibody NBP1-90158 (B).
Western Blot: Annexin A13 Antibody [NBP1-90157] - Analysis using Anti-ANXA13 antibody NBP1-90157 (A) shows similar pattern to independent antibody NBP1-90158 (B).
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PTGDR Antibody
H00005729-B01P
Western Blot: PTGDR Antibody [H00005729-B01P] - Analysis of PTGDR expression in transfected 293T cell line by PTGDR polyclonal antibody. Lane 1: PTGDR transfected lysate(39.6 KDa). Lane 2: Non-transfected lysate.
Flow Cytometry: PTGDR Antibody [H00005729-B01P] - Analysis of negative control 293 cells (Black) and PTGDR expressing 293 cells (Green) using PTGDR purified mouse polyclonal antibody.
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, WB
NFS1 Antibody
NBP2-37933
Immunohistochemistry-Paraffin: NFS1 Antibody [NBP2-37933] - Staining of human cerebral cortex, colon, kidney and testis using Anti-NFS1 antibody NBP2-37933 (A) shows similar protein distribution across tissues to independent antibody NBP2-38737 (B).
Immunohistochemistry-Paraffin: NFS1 Antibody [NBP2-37933] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: NFS1 Antibody [NBP2-37933] - Staining of human colon.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Desmoplakin
Antibody (824038) [Un ...
MAB9080
Western blot shows lysate of COLO 205 human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Desmoplakin Monoclonal Antibody (Catalog # MAB9080) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for Desmoplakin at approximately 260 and 330 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
RPS5 Antibody (4H3)
H00006193-M02
ELISA: RPS5 Antibody (4H3) [H00006193-M02] - Detection limit for recombinant GST tagged RPS5 is approximately 3ng/ml as a capture antibody.
Western Blot: RPS5 Antibody (4H3) [H00006193-M02] - Analysis of RPS5 expression in transfected 293T cell line by RPS5 monoclonal antibody (M02), clone 4H3.Lane 1: RPS5 transfected lysate(22.9 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: RPS5 Antibody (4H3) [H00006193-M02] - Analysis of monoclonal antibody to RPS5 on HeLa cell. Antibody concentration 10 ug/ml.
(2 Publications)
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
SUG1 Antibody
(25D5)
NB100-345
Knockdown Validated: SUG1 Antibody (25D5) [NB100-345] - Representative immunoblot for SUG1 antibody knockdown. Fifty micrograms of total protein was loaded in each lane. Actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3695522/) licensed under a CC-BY licence.
Western Blot: SUG1 Antibody (25D5) [NB100-345] - SUG1 antibody with 30 ug whole cell lysate run on SDS-PAGE. Lane A: 293T; B: A431; C: H1299; D: Hela; E: Hep G2; F: Molt-4; G: Raji 10% SDS PAGE diluted at 1:1000
(2 Reviews)
(4 Publications)
Species: Hu
Applications: ChIP, IP, KD, WB
Nav1.5 Antibody
(4G8:1G7)
NB110-61010
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on MG-63 cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on U2OS cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Immunocytochemistry/Immunofluorescence: Nav1.5 Antibody (4G8-1G7) [NB110-61010] - Figure A: Plasma membrane localisation of Nav1.5 identified by 4G8:1G7 detected by anti-mouse Alexa Fluor-488 conjugated antibody; Figure B, DAP1 co-staining of cell nuclei
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Carcinoma of kidney using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
SCN7A Antibody
NB100-81029
Immunohistochemistry-Paraffin: SCN7A Antibody [NB100-81029] - Staining of normal human heart tissue formalin fixed and paraffin embedded.
Immunocytochemistry/Immunofluorescence: SCN7A Antibody [NB100-81029] - Staining of sodium channel protein type 7 subunit alpha in human sperm cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Tau [p Thr181]
Antibody
NB100-82245
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - PPP2R2C level regulates Tau phosphatase levels. Representative image of immunoblots of indicated antibodies are shown in SHSY5Y cell lines after knockdown and overexpression PPP2R2C. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103048) licensed under a CC-BY licence.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
GLXR5 Antibody
NBP1-89897
Western Blot: GLXR5 Antibody [NBP1-89897] - Analysis in control (vector only transfected HEK293T lysate) and LY414008 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: GLXR5 Antibody [NBP1-89897] - Staining of human skeletal muscle shows strong granular cyotplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: GLXR5 Antibody [NBP1-89897] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and leydig cells.
Species: Hu
Applications: IHC, IHC-P, WB
OXSM Antibody
NBP1-84732
Western Blot: OXSM Antibody [NBP1-84732] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-OXSM antibody NBP1-84732 (A) shows similar protein distribution across tissues to independent antibody NBP1-84730 (B).
Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human kidney.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
OCTN1/SLC22A4
Antibody
H00006583-A01
Western Blot: OCTN1/SLC22A4 Antibody [H00006583-A01] - Analysis of SLC22A4 expression in Daoy.
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
HBLD2 Antibody
(2E9)
H00081689-M01
HBLD2 Antibody (2E9)
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for HBLD2 Antibody (H00081689-M01) (0)

There are no publications for HBLD2 Antibody (H00081689-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBLD2 Antibody (H00081689-M01) (0)

There are no reviews for HBLD2 Antibody (H00081689-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HBLD2 Antibody (H00081689-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HBLD2 Products

Bioinformatics Tool for HBLD2 Antibody (H00081689-M01)

Discover related pathways, diseases and genes to HBLD2 Antibody (H00081689-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HBLD2 Antibody (H00081689-M01)

Discover more about diseases related to HBLD2 Antibody (H00081689-M01).
 

Pathways for HBLD2 Antibody (H00081689-M01)

View related products by pathway.

Blogs on HBLD2

There are no specific blogs for HBLD2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HBLD2 Antibody (2E9) and receive a gift card or discount.


Bioinformatics

Gene Symbol ISCA1
Entrez
Uniprot