HARS2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of HARS2. Peptide sequence: LSIGVERIFYIVEQRMKTKGEKVRTTETQVFVATPQKNFLQERLKLIAEL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HARS2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for HARS2 Antibody - BSA Free
Background
The HARS2 gene encodes a 506 amino acid, 56kDA probable histidine--tRNA ligase (mitochondrial) protein that is member to the II family of aminoacyl-tRNA synthetases which charge tRNA with cognate amino acids. The HARS2 gene is located in a head-to-head orientation with HARS on chromosome 5, which is the location of where homologous genes share a bidirectional promoter. The protein works as an accessory in the regulation of protein biosynthesis through the synthesis of histidyl-transfer RNA. HARS2 is involved in gene expression and mitochondrian tRNA aminoacylation and has been known to interact with genes ICT1, AARS2, AASS, ABSB7, and ACAD9. HARS2 has been investigated in immunodeficiency, malaria, pneumonia, hearing loss, tuberculosis, schizophrenia, and ovarian dysgenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for HARS2 Antibody (NBP2-85025) (0)
There are no publications for HARS2 Antibody (NBP2-85025).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HARS2 Antibody (NBP2-85025) (0)
There are no reviews for HARS2 Antibody (NBP2-85025).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HARS2 Antibody (NBP2-85025) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HARS2 Products
Blogs on HARS2