We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

HADHA Recombinant Protein Antigen

Images

 
There are currently no images for HADHA Recombinant Protein Antigen (NBP2-54988PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HADHA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HADHA.

Source: E. coli

Amino Acid Sequence: DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HADHA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54988.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HADHA Recombinant Protein Antigen

  • 3-ketoacyl-Coenzyme A (CoA) thiolase, alpha subunit
  • 3-oxoacyl-CoA thiolase
  • 78 kDa gastrin-binding protein
  • ECHA
  • gastrin-binding protein
  • GBP
  • HADH
  • hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), alpha subunit
  • hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit
  • LCEH
  • LCHAD
  • long-chain 2-enoyl-CoA hydratase
  • long-chain-3-hydroxyacyl-CoA dehydrogenase
  • MGC1728
  • mitochondrial long-chain 2-enoyl-Coenzyme A (CoA) hydratase, alpha subunit
  • mitochondrial long-chain L-3-hydroxyacyl-Coenzyme A (CoA) dehydrogenase, alphasubunit
  • mitochondrial trifunctional enzyme, alpha subunit
  • mitochondrial trifunctional protein, alpha subunit
  • MTPATP-ALPHA
  • TP-alpha
  • trifunctional enzyme subunit alpha, mitochondrial

Background

HADHA encodes the alpha subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the alpha subunit catalyzing the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Mutations in this gene result in trifunctional protein deficiency or LCHAD deficiency. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
485-MI
Species: Mu
Applications: BA
NBP1-85958
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02118
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-10437
Species: Hu
Applications: WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NBP2-03972
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-82609
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KO, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-20183
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-84915
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for HADHA Recombinant Protein Antigen (NBP2-54988PEP) (0)

There are no publications for HADHA Recombinant Protein Antigen (NBP2-54988PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HADHA Recombinant Protein Antigen (NBP2-54988PEP) (0)

There are no reviews for HADHA Recombinant Protein Antigen (NBP2-54988PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HADHA Recombinant Protein Antigen (NBP2-54988PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HADHA Products

Research Areas for HADHA Recombinant Protein Antigen (NBP2-54988PEP)

Find related products by research area.

Blogs on HADHA

There are no specific blogs for HADHA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HADHA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HADHA