HACE1 Antibody (2B3)

Images

 
There are currently no images for HACE1 Antibody (H00057531-M04).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HACE1 Antibody (2B3) Summary

Immunogen
HACE1 (NP_065822, 800 a.a. ~ 909 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
Specificity
HACE1 - HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HACE1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HACE1 Antibody (2B3)

  • E3 ubiquitin-protein ligase HACE1
  • EC 6.3.2
  • HACE
  • HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
  • HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1
  • KIAA1320EC 6.3.2.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16389
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF1062
Species: Mu
Applications: IHC, Neut, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-77533
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB600-235
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-98549
Species: Hu
Applications: WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, MiAr, WB
H00064208-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-32352
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for HACE1 Antibody (H00057531-M04) (0)

There are no publications for HACE1 Antibody (H00057531-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HACE1 Antibody (H00057531-M04) (0)

There are no reviews for HACE1 Antibody (H00057531-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HACE1 Antibody (H00057531-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HACE1 Products

Bioinformatics Tool for HACE1 Antibody (H00057531-M04)

Discover related pathways, diseases and genes to HACE1 Antibody (H00057531-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HACE1 Antibody (H00057531-M04)

Discover more about diseases related to HACE1 Antibody (H00057531-M04).
 

Pathways for HACE1 Antibody (H00057531-M04)

View related products by pathway.

PTMs for HACE1 Antibody (H00057531-M04)

Learn more about PTMs related to HACE1 Antibody (H00057531-M04).
 

Research Areas for HACE1 Antibody (H00057531-M04)

Find related products by research area.

Blogs on HACE1

There are no specific blogs for HACE1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HACE1 Antibody (2B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HACE1
Entrez
Uniprot