HACE1 Antibody (2B3) - Azide and BSA Free Summary
| Immunogen |
HACE1 (NP_065822, 800 a.a. ~ 909 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA |
| Specificity |
HACE1 - HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
HACE1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against recombinant protein on ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for HACE1 Antibody (2B3) - Azide and BSA Free
Background
The HACE1 gene codes for a E3 ubiquitin-protein ligase HACE1 that is a participant in Golgi membrane fusion as well as in regulation of small GTPases to mediate ubiquitination and degradation of active RAC1, working in defense against pathogens. This protein may also play a role as a transcription regulator through its interaction with RARB. HACE1 exists in four isoforms: isoform 1 is 909 amino acids long, 102 kDA; isoform 2 is 318 amino acids long, 35 kDA; isoform 3 is 562 amino acids long, 63 kDA; isoform 4 is 694 amino acids long, nearly 78 kDA. HACE1 has been researched in regards to celiac disease, malaria, colorectal cancer, wilms tumors, and carcinoma. It is involved in the SMAD signaling network as well as ubiquitin-proteasome dependent proteolysis and has been known to interact with genes RARA, RAB4A, RAC1, PLXNA2, and IRF7.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, KD, WB
Publications for HACE1 Antibody (H00057531-M04) (0)
There are no publications for HACE1 Antibody (H00057531-M04).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HACE1 Antibody (H00057531-M04) (0)
There are no reviews for HACE1 Antibody (H00057531-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for HACE1 Antibody (H00057531-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HACE1 Products
Research Areas for HACE1 Antibody (H00057531-M04)
Find related products by research area.
|
Blogs on HACE1