HABP4 Antibody - BSA Free

Immunohistochemistry-Paraffin: HABP4 Antibody [NBP3-17861] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HABP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HABP4 Antibody - BSA Free (NBP3-17861) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEVEEETQVQEMTLDEWKNLQEQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFR
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HABP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HABP4 Antibody - BSA Free

• chromodomain helicase DNA binding protein 3 interacting protein
• hyaluronan binding protein 4
• IHABP-4
• IHABP4MGC825
• intracellular antigen detected by monoclonal Ki-1
• intracellular hyaluronan-binding protein 4
• Ki-1/57 intracellular antigen
• Ki-1/57
• SERBP1L

Background

HABP4 may be involved in nuclear functions such as the remodeling of chromatin and the regulation of transcription

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HABP4