HABP4 Antibody - Azide and BSA Free

Western Blot: HABP4 Antibody [NBP3-04108] - Analysis of extracts of various cell lines, using HABP4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HABP4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit HABP4 Antibody - Azide and BSA Free (NBP3-04108) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HABP4 (NP_055097.2). QQQLQRKRRDEAAAAAGAGPRGGRSPAGASGHRAGAGGRRESQKERKSLPAPVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGMLERAERRSYRE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HABP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500-1:2000
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for HABP4 Antibody - Azide and BSA Free

• chromodomain helicase DNA binding protein 3 interacting protein
• hyaluronan binding protein 4
• IHABP-4
• IHABP4MGC825
• intracellular antigen detected by monoclonal Ki-1
• intracellular hyaluronan-binding protein 4
• Ki-1/57 intracellular antigen
• Ki-1/57
• SERBP1L

Background

HABP4 may be involved in nuclear functions such as the remodeling of chromatin and the regulation of transcription

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: HABP4