HABP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HABP4 Antibody [NBP2-30907] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry: HABP4 Antibody [NBP2-30907] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HABP4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RGGPGNRVFDAFDQRGKREFERYGGNDKIAVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HABP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HABP4 Protein (NBP2-30907PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HABP4 Antibody

  • chromodomain helicase DNA binding protein 3 interacting protein
  • hyaluronan binding protein 4
  • IHABP-4
  • IHABP4MGC825
  • intracellular antigen detected by monoclonal Ki-1
  • intracellular hyaluronan-binding protein 4
  • Ki-1/57 intracellular antigen
  • Ki-1/57
  • SERBP1L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85660
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-30693
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52067
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-51593
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-259
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45429
Species: Hu
Applications: WB, IHC
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89546
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-30907
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HABP4 Antibody (NBP2-30907) (0)

There are no publications for HABP4 Antibody (NBP2-30907).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HABP4 Antibody (NBP2-30907) (0)

There are no reviews for HABP4 Antibody (NBP2-30907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HABP4 Antibody (NBP2-30907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HABP4 Products

Bioinformatics Tool for HABP4 Antibody (NBP2-30907)

Discover related pathways, diseases and genes to HABP4 Antibody (NBP2-30907). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HABP4 Antibody (NBP2-30907)

Discover more about diseases related to HABP4 Antibody (NBP2-30907).
 

Pathways for HABP4 Antibody (NBP2-30907)

View related products by pathway.

PTMs for HABP4 Antibody (NBP2-30907)

Learn more about PTMs related to HABP4 Antibody (NBP2-30907).

Blogs on HABP4

There are no specific blogs for HABP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HABP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HABP4
Uniprot