We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

HAAO Recombinant Protein Antigen

Images

 
There are currently no images for HAAO Protein (NBP1-85892PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HAAO Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HAAO.

Source: E. coli

Amino Acid Sequence: AWVKENRGSFQPPVCNKLMHQEQLKVMFVGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HAAO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85892.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HAAO Recombinant Protein Antigen

  • 3-HAO
  • 3-hydroxyanthranilate 3,4-dioxygenase
  • 3-hydroxyanthranilic acid dioxygenase
  • EC 1.13.11.6,3-hydroxyanthranilate oxygenase
  • HAD
  • HAO

Background

3-Hydroxyanthranilate 3,4-dioxygenase is a monomeric cytosolic protein belonging to the family of intramolecular dioxygenases containing nonheme ferrous iron. It is widely distributed in peripheral organs, such as liver and kidney, and is also present in low amounts in the central nervous system. HAAO catalyzes the synthesis of quinolinic acid (QUIN) from 3-hydroxyanthranilic acid. QUIN is an excitotoxin whose toxicity is mediated by its ability to activate glutamate N-methyl-D-aspartate receptors. Increased cerebral levels of QUIN may participate in the pathogenesis of neurologic and inflammatory disorders. HAAO has been suggested to play a role in disorders associated with altered tissue levels of QUIN. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
H00006999-B01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-86126
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NBP1-86335
Species: Hu
Applications: IHC,  IHC-P
MAB7389
Species: Mu
Applications: IHC, WB
NBP1-87702
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87069
Species: Hu, Mu
Applications: ICC/IF,  IHC-P, KD, Simple Western, WB
NBP2-48860
Species: Hu
Applications: IHC,  IHC-P
AF4479
Species: Hu
Applications: IHC
NBP1-79286
Species: Rt
Applications: WB
NBP2-45978
Species: Hu
Applications: Flow, IHC,  IHC-P, WB

Publications for HAAO Protein (NBP1-85892PEP) (0)

There are no publications for HAAO Protein (NBP1-85892PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAAO Protein (NBP1-85892PEP) (0)

There are no reviews for HAAO Protein (NBP1-85892PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HAAO Protein (NBP1-85892PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HAAO Products

Research Areas for HAAO Protein (NBP1-85892PEP)

Find related products by research area.

Blogs on HAAO

There are no specific blogs for HAAO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HAAO Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HAAO