H2AFV Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFV. Peptide sequence: MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGAT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
H2AZ2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for H2AFV Antibody - BSA Free
Background
H2AFV is 128 amino acids long, weighs approximately 13.5 kDa, and the gene codes for a variant component that is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. H2AFV has three shorter isoforms that are 114, 90, and 102 amino acids long, weighing 12, 9, and 11 kDa respectively. Current studies are being done on several diseases and disorders including systemic lupus erythematosus, lupus erythematosus, malaria, ataxia telangiectasia, intrahepatic cholangiocarcinoma, pharyngitis, and immunodeficiency. H2AFV has also been shown to have interactions with MORF4L1, MRGBP, PAX9, CAMSAP2, and ATG4C in pathways such as the systemic lupus erythematosus pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IF, IHC, IHC-Fr
Publications for H2AFV Antibody (NBP2-84057) (0)
There are no publications for H2AFV Antibody (NBP2-84057).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for H2AFV Antibody (NBP2-84057) (0)
There are no reviews for H2AFV Antibody (NBP2-84057).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for H2AFV Antibody (NBP2-84057) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional H2AFV Products
Research Areas for H2AFV Antibody (NBP2-84057)
Find related products by research area.
|
Blogs on H2AFV