Novus Biologicals products are now on bio-techne.com

GYG2 Antibody (3D10)

Images

 
Western Blot: GYG2 Antibody (3D10) [H00008908-M04] - Analysis of GYG2 expression in transfected 293T cell line by GYG2 monoclonal antibody (M04), clone 3D10. Lane 1: GYG2 transfected lysatE (55.212 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GYG2 Antibody (3D10) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
GYG2 (NP_003909, 392 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ
Specificity
GYG2 (3D10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GYG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publication using H00008908-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GYG2 Antibody (3D10)

  • glycogenin 2
  • glycogenin-2
  • GN-2GN2EC 2.4.1.186

Background

Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002992-M07
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89557
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP1-87486
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-84174
Species: Hu
Applications: WB
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
AF1640
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NB7276
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-92292
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-79776
Species: Hu, Rt
Applications: WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-38868
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-23368
Species: Hu
Applications: PAGE

Publications for GYG2 Antibody (H00008908-M04)(1)

Reviews for GYG2 Antibody (H00008908-M04) (0)

There are no reviews for GYG2 Antibody (H00008908-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GYG2 Antibody (H00008908-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GYG2 Antibody (3D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol GYG2
Entrez
OMIM
Uniprot