GULP1/CED-6 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GULP1/CED-6 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GULP1.
  
  

  Source: E. coli

  Amino Acid Sequence: KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GULP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84553.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GULP1/CED-6 Recombinant Protein Antigen

• CED6
• CED6GULPCED-6
• Cell death protein 6 homolog
• engulfment adapter protein
• FLJ31156
• GULP, engulfment adaptor PTB domain containing 1
• GULP1
• Protein GULP
• PTB domain adapter protein CED-6
• PTB domain adaptor protein CED-6
• PTB domain-containing engulfment adapter protein 1

Background

The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, as well as inflammation and autoimmunity. CED6 and its human homologue gulp, encode an adapter protein, whose function in engulfment. The upstream and downstream components of CED6 mediated signaling are not known. Recently, CED1 has been shown to encode a transmembrane protein on phagocytic cells, with two functional sequence motifs in its cytoplasmic tail that are important for engulfment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for GULP1/CED-6 Protein (NBP1-84553PEP). (Showing 1 - 1 of 1 FAQ).

1. Is GULP1 localized to mitochondria?
   • I am showing based on localization data from UniProt that it may associate with the cytoplasmic side of the plasma membrane: http://www.uniprot.org/uniprot/Q9UBP9 Additional localization data may be found here at Human protein atlas: http://www.proteinatlas.org/ENSG00000144366

Bioinformatics

• Gene Symbol: GULP1