GULP1/CED-6 Recombinant Protein Antigen

Images

 
There are currently no images for GULP1/CED-6 Protein (NBP1-84553PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GULP1/CED-6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GULP1.

Source: E. coli

Amino Acid Sequence: KTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GULP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84553.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GULP1/CED-6 Recombinant Protein Antigen

  • CED6
  • CED6GULPCED-6
  • Cell death protein 6 homolog
  • engulfment adapter protein
  • FLJ31156
  • GULP, engulfment adaptor PTB domain containing 1
  • GULP1
  • Protein GULP
  • PTB domain adapter protein CED-6
  • PTB domain adaptor protein CED-6
  • PTB domain-containing engulfment adapter protein 1

Background

The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, as well as inflammation and autoimmunity. CED6 and its human homologue gulp, encode an adapter protein, whose function in engulfment. The upstream and downstream components of CED6 mediated signaling are not known. Recently, CED1 has been shown to encode a transmembrane protein on phagocytic cells, with two functional sequence motifs in its cytoplasmic tail that are important for engulfment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64808
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-33645
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-873
Species: Hu
Applications: IHC, PEP-ELISA, WB
NB100-879
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-30945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
NBP1-84197
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
H00010438-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for GULP1/CED-6 Protein (NBP1-84553PEP) (0)

There are no publications for GULP1/CED-6 Protein (NBP1-84553PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GULP1/CED-6 Protein (NBP1-84553PEP) (0)

There are no reviews for GULP1/CED-6 Protein (NBP1-84553PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GULP1/CED-6 Protein (NBP1-84553PEP). (Showing 1 - 1 of 1 FAQ).

  1. Is GULP1 localized to mitochondria?
    • I am showing based on localization data from UniProt that it may associate with the cytoplasmic side of the plasma membrane: http://www.uniprot.org/uniprot/Q9UBP9 Additional localization data may be found here at Human protein atlas: http://www.proteinatlas.org/ENSG00000144366

Additional GULP1/CED-6 Products

Research Areas for GULP1/CED-6 Protein (NBP1-84553PEP)

Find related products by research area.

Blogs on GULP1/CED-6

There are no specific blogs for GULP1/CED-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GULP1/CED-6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GULP1