Novus Biologicals products are now on bio-techne.com

GTF3C2 Antibody

Images

 
Western Blot: GTF3C2 Antibody [NBP3-10918] - Western blot analysis using NBP3-10918 on r-GTF3C2 as a positive control. Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

GTF3C2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GTF3C2 (NP_001512). Peptide sequence YKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTETVNHHYLLFQDTDLG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF3C2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
101 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for GTF3C2 Antibody

  • general transcription factor 3C polypeptide 2
  • general transcription factor IIIC, polypeptide 2, beta 110kDa
  • KIAA0011general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD)
  • TF3C-beta
  • TFIIIC 110 kDa subunit
  • TFIIIC110Transcription factor IIIC 110 kDa subunit
  • TFIIIC-BETA
  • Transcription factor IIIC subunit beta

Background

General transcription factor 3C polypeptide 2 (GTF3C2/TFIIIC110) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. The functional contribution of GTF3C2/TFIIIC110 to the TFIIIC complex has not been fully determined. TFIIIC that is not associated with GTF3C2/TFIIIC110 has been purified, and it has been proposed that GTF3C2/TFIIIC110 functions to activate the TFIIIC complex for RNA polymerase III transcription. Recent studies argue against this model of GTF3C2/TFIIIC110 function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-60657
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP (-), WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for GTF3C2 Antibody (NBP3-10918) (0)

There are no publications for GTF3C2 Antibody (NBP3-10918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF3C2 Antibody (NBP3-10918) (0)

There are no reviews for GTF3C2 Antibody (NBP3-10918). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTF3C2 Antibody (NBP3-10918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF3C2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3C2