GTF2H1 Recombinant Protein Antigen

Images

 
There are currently no images for GTF2H1 Protein (NBP2-38556PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GTF2H1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF2H1.

Source: E.coli

Amino Acid Sequence: PEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF2H1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38556.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GTF2H1 Recombinant Protein Antigen

  • Basic transcription factor 2 62 kDa subunit
  • BTF2 p62
  • BTF2general transcription factor IIH, polypeptide 1 (62kD subunit)
  • General transcription factor IIH polypeptide 1
  • general transcription factor IIH subunit 1
  • general transcription factor IIH, polypeptide 1, 62kDa
  • TFB1
  • TFIIH basal transcription factor complex p62 subunit
  • TFIIH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-61060
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP2-67850
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, ChIP, CHIP-SEQ, KD
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74611
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-82774
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC

Publications for GTF2H1 Protein (NBP2-38556PEP) (0)

There are no publications for GTF2H1 Protein (NBP2-38556PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2H1 Protein (NBP2-38556PEP) (0)

There are no reviews for GTF2H1 Protein (NBP2-38556PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GTF2H1 Protein (NBP2-38556PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional GTF2H1 Products

Bioinformatics Tool for GTF2H1 Protein (NBP2-38556PEP)

Discover related pathways, diseases and genes to GTF2H1 Protein (NBP2-38556PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2H1 Protein (NBP2-38556PEP)

Discover more about diseases related to GTF2H1 Protein (NBP2-38556PEP).
 

Pathways for GTF2H1 Protein (NBP2-38556PEP)

View related products by pathway.

PTMs for GTF2H1 Protein (NBP2-38556PEP)

Learn more about PTMs related to GTF2H1 Protein (NBP2-38556PEP).
 

Research Areas for GTF2H1 Protein (NBP2-38556PEP)

Find related products by research area.

Blogs on GTF2H1

There are no specific blogs for GTF2H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LC3A Antibody
NB100-2331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GTF2H1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2H1