GTF2A2 Recombinant Protein Antigen

Images

 
There are currently no images for GTF2A2 Recombinant Protein Antigen (NBP2-55408PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GTF2A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF2A2.

Source: E. coli

Amino Acid Sequence: AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF2A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55408.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GTF2A2 Recombinant Protein Antigen

  • General transcription factor IIA subunit 2
  • general transcription factor IIA, 2 (12kD subunit)
  • general transcription factor IIA, 2, 12kDa
  • HsT18745
  • TF2A2
  • TFIIA p12 subunit
  • TFIIA
  • TFIIA-12
  • TFIIA-gamma
  • TFIIAS
  • Transcription initiation factor IIA gamma chain
  • transcription initiation factor IIA subunit 2

Background

Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-34143
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-15275
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP3-46159
Species: Hu, Mu, Rt
Applications: ELISA, IHC
NBP2-87539
Species: Hu
Applications: IHC,  IHC-P, WB
H00011036-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-47480
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55408PEP
Species: Hu
Applications: AC

Publications for GTF2A2 Recombinant Protein Antigen (NBP2-55408PEP) (0)

There are no publications for GTF2A2 Recombinant Protein Antigen (NBP2-55408PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2A2 Recombinant Protein Antigen (NBP2-55408PEP) (0)

There are no reviews for GTF2A2 Recombinant Protein Antigen (NBP2-55408PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GTF2A2 Recombinant Protein Antigen (NBP2-55408PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF2A2 Products

Blogs on GTF2A2

There are no specific blogs for GTF2A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GTF2A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2A2