GSTA1 Recombinant Protein Antigen

Images

 
There are currently no images for GSTA1 Recombinant Protein Antigen (NBP2-59732PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GSTA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GSTA1.

Source: E. coli

Amino Acid Sequence: GKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GSTA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59732.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GSTA1 Recombinant Protein Antigen

  • EC 1.11.1.-
  • EC 2.5.1.18
  • EC 5.3.3.-
  • glutathione S-alkyltransferase A1
  • glutathione S-aryltransferase A1
  • glutathione S-transferase 2
  • glutathione S-transferase A1
  • glutathione S-transferase alpha 1
  • glutathione S-transferase Ha subunit 1
  • GST class-alpha member 1
  • GST HA subunit 1
  • GST, class alpha, 1
  • GST2
  • GSTA1
  • GSTA1-1
  • GST-epsilon
  • GTH1
  • MGC131939
  • S-(hydroxyalkyl)glutathione lyase A1

Background

GSTA1 is glutathione S-transferase which are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00002946-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-32733
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-32157
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-209
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89342
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-32105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB

Publications for GSTA1 Recombinant Protein Antigen (NBP2-59732PEP) (0)

There are no publications for GSTA1 Recombinant Protein Antigen (NBP2-59732PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTA1 Recombinant Protein Antigen (NBP2-59732PEP) (0)

There are no reviews for GSTA1 Recombinant Protein Antigen (NBP2-59732PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GSTA1 Recombinant Protein Antigen (NBP2-59732PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GSTA1 Products

Research Areas for GSTA1 Recombinant Protein Antigen (NBP2-59732PEP)

Find related products by research area.

Blogs on GSTA1

There are no specific blogs for GSTA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GSTA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTA1