GRPEL1 Antibody - Azide and BSA Free

Western Blot: GRPEL1 Antibody [H00080273-B01P] - Analysis of GRPEL1 expression in NIH/3T3.

Western Blot: GRPEL1 Antibody [H00080273-B01P] - Analysis of GRPEL1 expression in transfected 293T cell line by GRPEL1 MaxPab polyclonal antibody. Lane 1: GRPEL1 transfected lysate (23.87 KDa). Lane 2: Non-transfected lysate.

Western Blot: GRPEL1 Antibody [H00080273-B01P] - Analysis of GRPEL1 expression in PC-12.

Western Blot: GRPEL1 Antibody [H00080273-B01P] - Analysis of GRPEL1 expression in Raw 264.7.

Western Blot: GRPEL1 Antibody [H00080273-B01P] - Analysis of GRPEL1 expression in Jurkat.

Western Blot: GRPEL1 Antibody [H00080273-B01P] - Analysis of GRPEL1 expression in transfected 293T cell line by GRPEL1 polyclonal antibody. Lane 1: GRPEL1 transfected lysate(23.87 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GRPEL1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse GRPEL1 Antibody - Azide and BSA Free (H00080273-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: GRPEL1 (NP_079472.1, 1 a.a. - 217 a.a.) full-length human protein. MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
• Specificity: GRPEL1 - GrpE-like 1, mitochondrial (E. coli),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GRPEL1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GRPEL1 Antibody - Azide and BSA Free

• FLJ25609
• GREPEL1
• grpE protein homolog 1, mitochondrial
• GrpE-like 1, mitochondrial (E. coli)
• GrpE-like protein cochaperone
• HMGEmt-GrpE#1
• Mt-GrpE#1

Background

Essential component of the PAM complex, a complex required for the translocation of transitpeptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems tocontrol the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRPEL1
• Entrez:
  • 80273(Human)
• Uniprot:
  • NP_079472.1(Human)