GRPEL1 Antibody - Azide and BSA Free Summary
| Immunogen |
GRPEL1 (NP_079472.1, 1 a.a. - 217 a.a.) full-length human protein. MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA |
| Specificity |
GRPEL1 - GrpE-like 1, mitochondrial (E. coli), |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
GRPEL1 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GRPEL1 Antibody - Azide and BSA Free
Background
Essential component of the PAM complex, a complex required for the translocation of transitpeptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems tocontrol the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
Species: Ca, Ch, Hu, Mu, Pm, Rb, Rt, RM, Xp, Ze
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ba, Ca, Ch, Fi, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Publications for GRPEL1 Antibody (H00080273-B01P) (0)
There are no publications for GRPEL1 Antibody (H00080273-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GRPEL1 Antibody (H00080273-B01P) (0)
There are no reviews for GRPEL1 Antibody (H00080273-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GRPEL1 Antibody (H00080273-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GRPEL1 Products
Research Areas for GRPEL1 Antibody (H00080273-B01P)
Find related products by research area.
|
Blogs on GRPEL1