GRPEL2 Antibody

Images

 
Western Blot: GRPEL2 Antibody [NBP1-85099] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: GRPEL2 Antibody [NBP1-85099] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GRPEL2 Antibody [NBP1-85099] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Western Blot: GRPEL2 Antibody [NBP1-85099] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: GRPEL2 Antibody [NBP1-85099] - Staining of human prostate shows strong cytoplasmic postivity in smooth muscle cells.
Immunohistochemistry-Paraffin: GRPEL2 Antibody [NBP1-85099] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GRPEL2 Antibody [NBP1-85099] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRPEL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRPEL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
ICC/IF reported in scientific literature (PMID: 30098457). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRPEL2 Protein (NBP1-85099PEP)
Publications
Read Publications using
NBP1-85099 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRPEL2 Antibody

  • FLJ23713
  • FLJ33918
  • GrpE-like 2, mitochondrial (E. coli)
  • Mt-GrpE#2mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83557
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for GRPEL2 Antibody (NBP1-85099)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-85099 Applications Species
Konovalova S, Liu X, Manjunath P et al. Redox regulation of GRPEL2 nucleotide exchange factor for mitochondrial HSP70 chaperone Redox Biol Aug 4 2018 [PMID: 30098457] (ICC/IF, Human) ICC/IF Human
Konovalova S, Torregrosa-Muñumer R, Manjunath P, et al. Small mitochondrial protein NERCLIN regulates cardiolipin homeostasis and mitochondrial ultrastructure bioRxiv Jan 4 2021

Reviews for GRPEL2 Antibody (NBP1-85099) (0)

There are no reviews for GRPEL2 Antibody (NBP1-85099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRPEL2 Antibody (NBP1-85099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRPEL2 Products

Bioinformatics Tool for GRPEL2 Antibody (NBP1-85099)

Discover related pathways, diseases and genes to GRPEL2 Antibody (NBP1-85099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GRPEL2

There are no specific blogs for GRPEL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRPEL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRPEL2