GRPEL2 Antibody

Western Blot: GRPEL2 Antibody [NBP1-85099] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: GRPEL2 Antibody [NBP1-85099] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GRPEL2 Antibody [NBP1-85099] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Western Blot: GRPEL2 Antibody [NBP1-85099] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: GRPEL2 Antibody [NBP1-85099] - Staining of human prostate shows strong cytoplasmic postivity in smooth muscle cells.

Immunohistochemistry-Paraffin: GRPEL2 Antibody [NBP1-85099] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GRPEL2 Antibody [NBP1-85099] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GRPEL2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRPEL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: ICC/IF reported in scientific literature (PMID: 30098457). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GRPEL2 Protein (NBP1-85099PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRPEL2 Antibody

• FLJ23713
• FLJ33918
• GrpE-like 2, mitochondrial (E. coli)
• Mt-GrpE#2mitochondrial

Background

Essential component of the PAM complex, a complex required for the translocation of transitpeptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems tocontrol the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Stimulates ATPase activity ofmt-HSP70. May also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms ofmt-HSP70

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRPEL2 Antibody (NBP1-85099)(2)

Publications using NBP1-85099

• Konovalova S, Liu X, Manjunath P et al. Redox regulation of GRPEL2 nucleotide exchange factor for mitochondrial HSP70 chaperone Redox Biol 2018-08-04 [PMID: 30098457] (ICC/IF, Human)
• Konovalova S, Torregrosa-Muñumer R, Manjunath P, et al. Small mitochondrial protein NERCLIN regulates cardiolipin homeostasis and mitochondrial ultrastructure bioRxiv 2021-01-04

Bioinformatics

• Gene Symbol: GRPEL2