Recombinant Human GRHL3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GRHL3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 101-200 of Human GRHL3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVPPTQRWQPD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRHL3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GRHL3 Protein

  • grainyhead-like 3 (Drosophila)
  • MGC46624
  • Sister of mammalian grainyhead
  • sister-of-mammalian grainyhead
  • SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog
  • TFCP2L4
  • transcription factor hSOM1

Background

GRHL3 - grainyhead-like 3 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for GRHL3 Partial Recombinant Protein (H00057822-Q01) (0)

There are no publications for GRHL3 Partial Recombinant Protein (H00057822-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRHL3 Partial Recombinant Protein (H00057822-Q01) (0)

There are no reviews for GRHL3 Partial Recombinant Protein (H00057822-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRHL3 Partial Recombinant Protein (H00057822-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRHL3 Products

Bioinformatics Tool for GRHL3 Partial Recombinant Protein (H00057822-Q01)

Discover related pathways, diseases and genes to GRHL3 Partial Recombinant Protein (H00057822-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRHL3 Partial Recombinant Protein (H00057822-Q01)

Discover more about diseases related to GRHL3 Partial Recombinant Protein (H00057822-Q01).
 

Pathways for GRHL3 Partial Recombinant Protein (H00057822-Q01)

View related products by pathway.

PTMs for GRHL3 Partial Recombinant Protein (H00057822-Q01)

Learn more about PTMs related to GRHL3 Partial Recombinant Protein (H00057822-Q01).

Blogs on GRHL3

There are no specific blogs for GRHL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GRHL3 Antibody
NBP1-80356
iNOS Antibody
NB300-605

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GRHL3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRHL3