GRHL1 Antibody - BSA Free

Western Blot: GRHL1 Antibody [NBP3-10919] - Western blot analysis using NBP3-10919 on Human Jurkat as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GRHL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GRHL1 Antibody - BSA Free (NBP3-10919) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GRHL1 (NP_055367). Peptide sequence GENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTAPDTTVTVSIATMPTHSI
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRHL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GRHL1 Antibody - BSA Free

• grainyhead-like 1 (Drosophila)
• grainyhead-like protein 1 homolog
• LBP protein 32
• MGRLBP-32
• NH32
• TFCP2L2
• Transcription factor CP2-like 2LBP32Mammalian grainyhead
• Transcription factor LBP-32

Background

GRHL1 encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with sister of mammalian grainyhead (SOM) and may function as a transcription factor during development. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRHL1