Recombinant Human GRF2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GRF2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human RAPGEF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSW

Protein/Peptide Type
Partial Recombinant Protein
Gene
RAPGEF1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GRF2 Protein

  • C3GGRF2guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene)
  • CRK SH3-binding GNRP
  • DKFZp781P1719
  • Guanine nucleotide-releasing factor 2
  • Protein C3G
  • Rap guanine nucleotide exchange factor (GEF) 1
  • rap guanine nucleotide exchange factor 1

Background

RAPGEF1 - Rap guanine nucleotide exchange factor (GEF) 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF6260
Species: Hu
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF7070
Species: Hu, Rt
Applications: WB

Publications for GRF2 Partial Recombinant Protein (H00002889-Q01) (0)

There are no publications for GRF2 Partial Recombinant Protein (H00002889-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRF2 Partial Recombinant Protein (H00002889-Q01) (0)

There are no reviews for GRF2 Partial Recombinant Protein (H00002889-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRF2 Partial Recombinant Protein (H00002889-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRF2 Products

Bioinformatics Tool for GRF2 Partial Recombinant Protein (H00002889-Q01)

Discover related pathways, diseases and genes to GRF2 Partial Recombinant Protein (H00002889-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRF2 Partial Recombinant Protein (H00002889-Q01)

Discover more about diseases related to GRF2 Partial Recombinant Protein (H00002889-Q01).
 

Pathways for GRF2 Partial Recombinant Protein (H00002889-Q01)

View related products by pathway.

PTMs for GRF2 Partial Recombinant Protein (H00002889-Q01)

Learn more about PTMs related to GRF2 Partial Recombinant Protein (H00002889-Q01).
 

Research Areas for GRF2 Partial Recombinant Protein (H00002889-Q01)

Find related products by research area.

Blogs on GRF2

There are no specific blogs for GRF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GRF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPGEF1