GRB 14 Recombinant Protein Antigen

Images

 
There are currently no images for GRB 14 Protein (NBP2-38230PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GRB 14 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GRB14.

Source: E. coli

Amino Acid Sequence: PELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GRB14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38230.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GRB 14 Recombinant Protein Antigen

  • GRB14 adapter protein
  • growth factor receptor-bound protein 14

Background

Many growth factors function by binding receptors with intrinsic tyrosine kinase activity. Signaling by such receptors involves a series of intermediates characterized by SH2 domains that bind tyrosine phosphorylated receptors by a direct interaction between the SH2 domain and specific phosphotyrosine-containing receptor sequences. GRB7, a SH2 domain protein, has a single SH2 domain at its C-terminal, a central region with similarity to Ras GAP and a proline-rich N terminus. A related SH2 domain-containing protein, GRB10, exhibits a high degree of homology with GRB7. GRB10 undergoes serine but not tyrosine phosphorylation in response to EGF treatment, but appears to bind to the EGF receptor poorly. An additional member of the GRB7 family, designated GRB14, contains a pleckstrin homology domain in its central region and a carboxy terminal SH2 domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12793
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF4856
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-88153
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-48615
Species: Hu
Applications: IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB100-82001
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
788-G8/CF
Species: Hu, Mu, Rt
Applications: BA
AF313
Species: Hu
Applications: Block, IHC, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
664-LI
Species: Hu
Applications: BA
NBP2-38230PEP
Species: Hu
Applications: AC

Publications for GRB 14 Protein (NBP2-38230PEP) (0)

There are no publications for GRB 14 Protein (NBP2-38230PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRB 14 Protein (NBP2-38230PEP) (0)

There are no reviews for GRB 14 Protein (NBP2-38230PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GRB 14 Protein (NBP2-38230PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRB 14 Products

Research Areas for GRB 14 Protein (NBP2-38230PEP)

Find related products by research area.

Blogs on GRB 14

There are no specific blogs for GRB 14, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GRB 14 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GRB14