GRASP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GRASP. Source: E. coli
Amino Acid Sequence: VEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTSIRKAELEARLQYLKQTLYEKWG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TAMALIN |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88108. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GRASP Recombinant Protein Antigen
Background
PDZ domain-containing proteins, such as PSD-95 and GRIP are thought to play key roles in glutamate receptor plasticity. GRIP-associated proteins (GRASPs) that bind to distinct PDZ domains within GRIP also play key roles in regulation of glutamate receptor function. GRASP-1 is a neuronal rasGEF associated with GRIP and AMPA receptors in vivo. Recent work suggests that GRASP-1 may regulate neuronal ras signaling and contribute to the regulation of AMPA receptor distribution by NMDA receptor activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: AC
Publications for GRASP Recombinant Protein Antigen (NBP1-88108PEP) (0)
There are no publications for GRASP Recombinant Protein Antigen (NBP1-88108PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GRASP Recombinant Protein Antigen (NBP1-88108PEP) (0)
There are no reviews for GRASP Recombinant Protein Antigen (NBP1-88108PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GRASP Recombinant Protein Antigen (NBP1-88108PEP) (0)
Additional GRASP Products
Research Areas for GRASP Recombinant Protein Antigen (NBP1-88108PEP)
Find related products by research area.
|
Blogs on GRASP