Granzyme H Antibody

Images

 
Western Blot: Granzyme H Antibody [H00002999-B01P] - Analysis of GZMH expression in human spleen.
Western Blot: Granzyme H Antibody [H00002999-B01P] - Analysis of GZMH expression in human colon.
Western Blot: Granzyme H Antibody [H00002999-B01P] - Analysis of GZMH expression in transfected 293T cell line by GZMH polyclonal antibody. Lane 1: GZMH transfected lysate(27.17 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Granzyme H Antibody Summary

Immunogen
GZMH (AAH27974, 1 a.a. - 246 a.a.) full-length human protein. MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Specificity
GZMH - granzyme H (cathepsin G-like 2, protein h-CCPX),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GZMH
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and tissue lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Granzyme H Antibody

  • Cathepsin G-like 2
  • CCP-X
  • CCP-Xcytotoxic T-lymphocyte-associated serine esterase 1
  • CGL2
  • CGL-2
  • CSP-Ccytotoxin serine protease-C
  • CTLA1
  • CTSGL2
  • CTSGL2granzyme H
  • Cytotoxic serine protease C
  • Cytotoxic T-lymphocyte proteinase
  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.79
  • granzyme H (cathepsin G-like 2, protein h-CCPX)
  • Granzyme H
  • GrzH
  • GZMH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
AF7385
Species: Hu
Applications: WB, ICC
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF6667
Species: Mu
Applications: WB, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS

Publications for Granzyme H Antibody (H00002999-B01P) (0)

There are no publications for Granzyme H Antibody (H00002999-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granzyme H Antibody (H00002999-B01P) (0)

There are no reviews for Granzyme H Antibody (H00002999-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granzyme H Antibody (H00002999-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Granzyme H Products

Bioinformatics Tool for Granzyme H Antibody (H00002999-B01P)

Discover related pathways, diseases and genes to Granzyme H Antibody (H00002999-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme H Antibody (H00002999-B01P)

Discover more about diseases related to Granzyme H Antibody (H00002999-B01P).
 

Pathways for Granzyme H Antibody (H00002999-B01P)

View related products by pathway.

PTMs for Granzyme H Antibody (H00002999-B01P)

Learn more about PTMs related to Granzyme H Antibody (H00002999-B01P).
 

Research Areas for Granzyme H Antibody (H00002999-B01P)

Find related products by research area.

Blogs on Granzyme H

There are no specific blogs for Granzyme H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Granzyme H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GZMH
Entrez
Uniprot