Recombinant Human GPX8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GPX8 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 209 of Human GPX8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL

Protein/Peptide Type
Recombinant Protein
Gene
GPX8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPX8 Protein

  • EC 1.11.1
  • EC 1.11.1.9
  • EPLA847
  • glutathione peroxidase 8 (putative)
  • GPx-8
  • GSHPx-8
  • probable glutathione peroxidase 8
  • UNQ847

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-344
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-07799
Species: Hu
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
AF4817
Species: Mu
Applications: WB
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00493869-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GPX8 Recombinant Protein (H00493869-P01) (0)

There are no publications for GPX8 Recombinant Protein (H00493869-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPX8 Recombinant Protein (H00493869-P01) (0)

There are no reviews for GPX8 Recombinant Protein (H00493869-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPX8 Recombinant Protein (H00493869-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPX8 Products

Bioinformatics Tool for GPX8 Recombinant Protein (H00493869-P01)

Discover related pathways, diseases and genes to GPX8 Recombinant Protein (H00493869-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPX8 Recombinant Protein (H00493869-P01)

Discover more about diseases related to GPX8 Recombinant Protein (H00493869-P01).

PTMs for GPX8 Recombinant Protein (H00493869-P01)

Learn more about PTMs related to GPX8 Recombinant Protein (H00493869-P01).

Blogs on GPX8

There are no specific blogs for GPX8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GPX8 Antibody
NBP2-48664

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPX8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPX8