GPRASP2 Antibody

Images

 
Western Blot: GPRASP2 Antibody [NBP1-83480] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-248
Immunocytochemistry/ Immunofluorescence: GPRASP2 Antibody [NBP1-83480] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: GPRASP2 Antibody [NBP1-83480] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPRASP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPLVVRPKVRTQATTGARPKTETKSVPAARPKTEAQAMSGARPKTEVQVMGGARPKTEAQGITGARPKTDARAVGGARSKTDAKAIPGARPKDEAQAWAQSEFGTEAVSQAEGVSQTNA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPRASP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPRASP2 Protein (NBP1-83480PEP)
Publications
Read Publication using NBP1-83480.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPRASP2 Antibody

  • FLJ35662
  • FLJ37327
  • G protein-coupled receptor associated sorting protein 2
  • GASP2
  • GASP-2
  • GPRASP2
  • G-protein coupled receptor-associated sorting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-83391
Species: Hu
Applications: IHC, IHC-P
NBL1-10101
Species: Hu
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
AF2657
Species: Hu
Applications: WB
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-93703
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88828
Species: Hu
Applications: IHC, IHC-P
NBP2-52493
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00004168-B01P-50ug
Species: Hu
Applications: WB
AF2070
Species: Hu
Applications: WB, IP, Neut
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC

Publications for GPRASP2 Antibody (NBP1-83480)(1)

Reviews for GPRASP2 Antibody (NBP1-83480) (0)

There are no reviews for GPRASP2 Antibody (NBP1-83480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPRASP2 Antibody (NBP1-83480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPRASP2 Products

Bioinformatics Tool for GPRASP2 Antibody (NBP1-83480)

Discover related pathways, diseases and genes to GPRASP2 Antibody (NBP1-83480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPRASP2 Antibody (NBP1-83480)

Discover more about diseases related to GPRASP2 Antibody (NBP1-83480).

Blogs on GPRASP2

There are no specific blogs for GPRASP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPRASP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPRASP2
Entrez