GPRASP1 Antibody

Images

 
Immunohistochemistry-Paraffin: GPRASP1 Antibody [NBP1-83391] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPRASP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VEACVEGDVNSKSSLEDKEEAMIPCFGAKEEVSMKHGTGVRCRFMAGAEETNNKSCFWAEKEPCMYPAGGGSWKSRPEEEEDIVNSWFWSRKYTKPEAIIGSWLWATEESNIDGTGEKAKLLTEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPRASP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPRASP1 Protein (NBP1-83391PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPRASP1 Antibody

  • G protein-coupled receptor associated sorting protein 1
  • GASP1
  • GASPKIAA0443GASP-1
  • G-protein coupled receptor-associated sorting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
AF2070
Species: Hu
Applications: WB, IP, Neut
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13370
Species: Hu
Applications: WB, IHC, IHC-P
MAB7078
Species: Hu
Applications: WB, IHC
NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPRASP1 Antibody (NBP1-83391) (0)

There are no publications for GPRASP1 Antibody (NBP1-83391).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPRASP1 Antibody (NBP1-83391) (0)

There are no reviews for GPRASP1 Antibody (NBP1-83391). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPRASP1 Antibody (NBP1-83391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPRASP1 Products

Bioinformatics Tool for GPRASP1 Antibody (NBP1-83391)

Discover related pathways, diseases and genes to GPRASP1 Antibody (NBP1-83391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPRASP1 Antibody (NBP1-83391)

Discover more about diseases related to GPRASP1 Antibody (NBP1-83391).
 

Pathways for GPRASP1 Antibody (NBP1-83391)

View related products by pathway.

PTMs for GPRASP1 Antibody (NBP1-83391)

Learn more about PTMs related to GPRASP1 Antibody (NBP1-83391).

Blogs on GPRASP1

There are no specific blogs for GPRASP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPRASP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPRASP1