We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GPR78 Recombinant Protein Antigen

Images

 
There are currently no images for GPR78 Recombinant Protein Antigen (NBP1-86467PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPR78 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR78.

Source: E. coli

Amino Acid Sequence: RLAELVPFVTVNAQWGILSKCLTYSKAVADPFTYSLLRRPFRQVLAGMVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDSCLQQTH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPR78
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86467.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPR78 Recombinant Protein Antigen

  • G protein-coupled receptor 78
  • GPR78
  • G-protein coupled receptor 78

Background

The protein encoded by this gene belongs to the G protein-coupled receptor family, which contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. This is an orphan receptor, which displays significant level of constitutive activity. Association analysis shows preliminary evidence for the involvement of this gene in susceptibility to bipolar affective disorder and schizophrenia. Alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-80849
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB8449
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-01354
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NBP1-76801
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-86659
Species: Hu
Applications: WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NLS1922
Species: Hu
Applications: IHC,  IHC-P
NLS418
Species: Hu
Applications: IHC,  IHC-P
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-72115
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-86467PEP
Species: Hu
Applications: AC

Publications for GPR78 Recombinant Protein Antigen (NBP1-86467PEP) (0)

There are no publications for GPR78 Recombinant Protein Antigen (NBP1-86467PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR78 Recombinant Protein Antigen (NBP1-86467PEP) (0)

There are no reviews for GPR78 Recombinant Protein Antigen (NBP1-86467PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPR78 Recombinant Protein Antigen (NBP1-86467PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR78 Products

Research Areas for GPR78 Recombinant Protein Antigen (NBP1-86467PEP)

Find related products by research area.

Blogs on GPR78.

GPR78 - an orphan receptor involved in psychiatric illness
G-protein coupled receptor 78 (GPR78) was identified based on homology to other GPCR family members. The GPR78 gene encodes an orphan receptor protein that is 363 amino acids in length and contains the typical seven transmembrane domain found in G...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPR78 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR78