GPR74/NPFFR2 Antibody (NBP1-69144)


Western Blot: NPFFR2 Antibody [NBP1-69144] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

GPR74/NPFFR2 Antibody Summary

Synthetic peptides corresponding to NPFFR2 (neuropeptide FF receptor 2) The peptide sequence was selected from the middle region of NPFFR2. Peptide sequence VPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NPFFR2 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPR74/NPFFR2 Antibody

  • GPR74
  • GPR74G protein-coupled receptor 74
  • G-protein coupled receptor 74
  • neuropeptide FF 2
  • neuropeptide FF receptor 2
  • Neuropeptide G-protein coupled receptor
  • NPFF2
  • NPFF2G-protein coupled receptor HLWAR77
  • NPFFR2


This gene encodes a member of a subfamily of G-protein-coupled neuropeptide receptors. This protein is activated by the neuropeptides A-18-amide (NPAF) and F-8-amide (NPFF) and may function in pain modulation and regulation of the opioid system. Alternative splicing results in multiple transcript variants.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Po, Bv, Eq, Mk, Pm, Rb
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P

Publications for GPR74/NPFFR2 Antibody (NBP1-69144) (0)

There are no publications for GPR74/NPFFR2 Antibody (NBP1-69144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR74/NPFFR2 Antibody (NBP1-69144) (0)

There are no reviews for GPR74/NPFFR2 Antibody (NBP1-69144). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR74/NPFFR2 Antibody (NBP1-69144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPR74/NPFFR2 Antibody Products

Related Products by Gene

Bioinformatics Tool for GPR74/NPFFR2 Antibody (NBP1-69144)

Discover related pathways, diseases and genes to GPR74/NPFFR2 Antibody (NBP1-69144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR74/NPFFR2 Antibody (NBP1-69144)

Discover more about diseases related to GPR74/NPFFR2 Antibody (NBP1-69144).

Pathways for GPR74/NPFFR2 Antibody (NBP1-69144)

View related products by pathway.

PTMs for GPR74/NPFFR2 Antibody (NBP1-69144)

Learn more about PTMs related to GPR74/NPFFR2 Antibody (NBP1-69144).

Research Areas for GPR74/NPFFR2 Antibody (NBP1-69144)

Find related products by research area.

Blogs on GPR74/NPFFR2

There are no specific blogs for GPR74/NPFFR2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPR74/NPFFR2 Antibody and receive a gift card or discount.


Gene Symbol NPFFR2

Customers Who Bought This Also Bought