GPR74/NPFFR2 Antibody

Images

 
Western Blot: NPFFR2 Antibody [NBP1-69144] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

GPR74/NPFFR2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NPFFR2 (neuropeptide FF receptor 2) The peptide sequence was selected from the middle region of NPFFR2. Peptide sequence VPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYA.
Clonality
Polyclonal
Host
Rabbit
Gene
NPFFR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NPFFR2 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPR74/NPFFR2 Antibody

  • GPR74/NPFFR2
  • GPR74G protein-coupled receptor 74
  • G-protein coupled receptor 74
  • neuropeptide FF 2
  • neuropeptide FF receptor 2
  • Neuropeptide G-protein coupled receptor
  • NPFF2
  • NPFF2G-protein coupled receptor HLWAR77
  • NPFFR2
  • NPGPR
  • NPGPRHLWAR77

Background

This gene encodes a member of a subfamily of G-protein-coupled neuropeptide receptors. This protein is activated by the neuropeptides A-18-amide (NPAF) and F-8-amide (NPFF) and may function in pain modulation and regulation of the opioid system. Alternative splicing results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-168
Species: Hu
Applications: WB
NBP1-86724
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NLS415
Species: Hu, Mk
Applications: IHC-P
NBP2-33864
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84903
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, ICC
NLS2576
Species: Hu, Mk
Applications: IHC-P
MAB763
Species: Hu, Mu, Rt
Applications: IHC
H00005696-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NLS1922
Species: Hu
Applications: IHC-P
NBP1-69144
Species: Hu
Applications: WB

Publications for GPR74/NPFFR2 Antibody (NBP1-69144) (0)

There are no publications for GPR74/NPFFR2 Antibody (NBP1-69144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR74/NPFFR2 Antibody (NBP1-69144) (0)

There are no reviews for GPR74/NPFFR2 Antibody (NBP1-69144). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR74/NPFFR2 Antibody (NBP1-69144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR74/NPFFR2 Antibody Products

Related Products by Gene

Bioinformatics Tool for GPR74/NPFFR2 Antibody (NBP1-69144)

Discover related pathways, diseases and genes to GPR74/NPFFR2 Antibody (NBP1-69144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR74/NPFFR2 Antibody (NBP1-69144)

Discover more about diseases related to GPR74/NPFFR2 Antibody (NBP1-69144).
 

Pathways for GPR74/NPFFR2 Antibody (NBP1-69144)

View related products by pathway.

PTMs for GPR74/NPFFR2 Antibody (NBP1-69144)

Learn more about PTMs related to GPR74/NPFFR2 Antibody (NBP1-69144).
 

Research Areas for GPR74/NPFFR2 Antibody (NBP1-69144)

Find related products by research area.

Blogs on GPR74/NPFFR2

There are no specific blogs for GPR74/NPFFR2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NPFFR2
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69144 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought