GPR56 Antibody - BSA Free

Western Blot: GPR56 Antibody [NBP1-62637] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR56 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GPR56(G protein-coupled receptor 56) The peptide sequence was selected form the N terminal of GPR56. Peptide sequence MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADGRG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR56 Antibody - BSA Free

• BFPP
• EGF-TM7-like
• G protein-coupled receptor 56,7-transmembrane protein with no EGF-like N-terminal domains-1
• GPR56
• Protein TM7XN1
• TM7LN4
• TM7LN4G-protein coupled receptor 56
• TM7XN1
• TM7XN1DKFZp781L1398

Background

GPR56 could be involved in cell-cell interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADGRG1
• OMIM:
  • NP_005673(Human)
• Uniprot:
  • Q9Y653()