GPR55 Antibody - Azide and BSA Free

Western Blot: GPR55 Antibody [NBP3-04847] - Analysis of extracts of various cell lines, using GPR55 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunocytochemistry/ Immunofluorescence: GPR55 Antibody - Azide and BSA Free [NBP3-04847] - Immunofluorescence analysis of paraffin-embedded rat bone marrow using GPR55 Rabbit pAb (A12890) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GPR55 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit GPR55 Antibody - Azide and BSA Free (NBP3-04847) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-319 of human GPR55 (NP_005674.2). GRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR55
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for GPR55 Antibody - Azide and BSA Free

• G protein-coupled receptor 55
• Gm218
• GPR55
• G-protein coupled receptor 55

Background

GPR55 is an Orphan-A GPCR with an unknown ligand. GPR55 has been reported to be expressed in the brain, where mRNA transcripts were detected in the caudate nucleus and putamen, but not in five other brain regions (Sawzdargo et al., 1999). ESTs have been isolated from liver/spleen libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GPR55