GPR171 Antibody - Azide and BSA Free

Western Blot: GPR171 Antibody [NBP3-03890] - Analysis of extracts of Rat pancreas, using GPR171 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Product Discontinued

GPR171 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GPR171 (NP_037440.3). LSIIFLAFVSIDRCLQLTHSCKIYRIQEPGFAKMISTVVWLMVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLTNFICVAIFLNFSAIILISNC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR171
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for GPR171 Antibody - Azide and BSA Free

• F730001G15Rik
• G protein-coupled receptor 171
• GPR171
• G-protein coupled receptor H963
• H963
• H963platelet activating receptor homolog
• probable G-protein coupled receptor 171

Background

Platelet Activating Receptor H963 is an orphan receptor that is a member of the Platelet Activating Factor Receptor subfamily. ESTs have been isolated from normal human blood (activated), liver, and testis libraries, and from a human uterine adenocarcinoma library.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GPR171